Atlas Peptides

Premium US peptide vendor with same-day processing and free shipping.

What Customers Mention

tookvialshippingdaysvialsfinepackaginglooked

Reviews

Jul 14, 2026
plain packaging
Joseph R.

Got my 5-amino-1MQ in a basic padded mailer with no ice pack. It was summer so I would have liked some cold protection. Vial was full and sealed at least.

Jun 27, 2026
great service
Jenna K.

Emailed them a question about the tesamorelin listing and got a real answer within a couple hours. Order showed up well packed, vials all intact. Happy customer.

Jun 12, 2026
COA wasn't batch specific
Graham F.

The certificate they sent over didn't have a lot number that matched my vial, just a generic sheet for the compound. For a research order that matters to me, so I'm holding off on reordering until they sort that out.

May 31, 2026
fine but slow
helena805

Took about nine days from order to delivery, which is longer than I expected. Product itself was fine and the vials were sealed well. Just wish the processing was quicker.

May 19, 2026
solid first order
Renee G.

Ordered BPC-157 and the GHK-Cu. Both vials looked properly filled and the COA was waiting in my email before the package even moved. No complaints for a smaller shop.

Apr 29, 2026
reordered, no issues
Naomi Y.

Second order from them and it went smoother than the first. COA matched the batch this time and it shipped within a day or two. Pricing stays reasonable.

Mar 26, 2026
underfilled vial
Connor K.

One of my two vials looked noticeably underfilled compared to the other. Emailed about it and the reply was polite but slow. Not a great first impression.

Feb 18, 2026
SLU-PP-332 was out of stock
Brenda A.

Wanted to grab SLU-PP-332 but it was unavailable for a couple weeks. Ended up ordering GHK-Cu instead, that part was fine. Wish they kept stock more consistent.

Jan 15, 2026
BPC came through clean
Victoria D.

Reconstituted clear with no floaters. Fill looked accurate against the label. Shipping was about average, maybe 6 days.

Jan 5, 2026
Quality concerns with recent order
Blake Russell

Have been using Atlas for about 6 months and this latest order was disappointing. Got Semaglutide and CJC-1295 for research. The Semaglutide vial had some particulate matter floating in it even before reconstitution which is concerning. The CJC looked fine but when I contacted customer service about the Semaglutide issue they were slow to respond - took 5 days to get back to me and then just offered a replacement without much explanation. The COAs both looked legitimate with good purity numbers but seeing visible particles makes me question the handling. Previous orders from them were flawless so not sure what happened this time. Shipping was standard 6-7 days. Hoping this was just a one-off quality control miss but it's made me more cautious.

Dec 9, 2025
support is slow to reply
Catherine K.

Had a question about stock and it took three days to hear back over email. Order itself was fine once it shipped.

Verified Purchase
Dec 3, 2025
Comprehensive research order fulfilled well
Douglas Park

Received an invitation to review my recent order from Atlas Peptides and figured I'd share my experience. Ordered Semaglutide, TB-500, and GHK-Cu for different research protocols we're running. All three came with detailed certificates of analysis from independent labs which gave me confidence in the purity claims. The Semaglutide was particularly impressive - tested at 98.9% which is among the highest I've seen from any vendor. TB-500 and GHK-Cu were both above 98% as well. Shipping took about 7 days which was within their stated timeframe. Everything was packaged individually with proper temperature monitoring stickers. The vials themselves are high quality borosilicate glass with crisp clear labeling including batch numbers and expiration dates. Customer service was responsive when I had questions about reconstitution protocols for the GHK-Cu. Pricing is on the higher end but justified by the quality control measures they clearly have in place. The one thing that could be better is their website checkout process - had to re-enter my info twice due to some glitch. But the product quality more than makes up for minor technical issues. Would definitely order from Atlas again for future research needs.

Dec 3, 2025
Thorough experience with Atlas research peptides
Erica Hoffman

This is my second large order from Atlas Peptides and I wanted to give a comprehensive review since I've now used them extensively for research purposes. Got BPC-157 and Retatrutide this time around. The BPC-157 is probably the cleanest I've worked with - perfect reconstitution with zero cloudiness and the COA showed 99.3% purity from an accredited third-party lab. The Retatrutide is newer to their catalog but equally impressive at 98.6% purity. What really sets Atlas apart is their attention to detail in packaging. Each vial comes with its own protective case, there's a temperature log sticker to ensure cold chain wasn't broken during shipping, and they include detailed handling instructions specific to each peptide. Shipping took 6 days via expedited service. Their customer portal is well designed - easy to track orders, download COAs, and manage subscriptions if you're doing ongoing research. Pricing is definitely premium but you're getting pharmaceutical-grade quality control. The website has extensive documentation about peptide stability and storage which is helpful for research planning. My only critique would be that their email notifications could be more detailed - I got a shipping notice but no tracking number initially and had to log into the portal to find it. Also their customer service hours are limited to business days which can be inconvenient. But these are minor issues compared to the product quality. If you're doing serious research and need reliable high-purity peptides I'd definitely recommend Atlas. Not the cheapest option but worth it for peace of mind.

Nov 22, 2025
decent but plain packaging
Janet Q.

No complaints about the actual vials, sealed and labeled correctly. Just a plain bubble mailer, nothing protective beyond that. Got the job done though.

Nov 3, 2025
happy with my order
Gabriel U.

Tesamorelin and 5-amino-1MQ both came well packed with an ice pack still cold. COAs included for each. Smooth checkout too.

Oct 23, 2025
Perfect Ipamorelin source
Sharon Ellis

Atlas Peptides has the best Ipamorelin I've found. Also got their CJC/Ipa blend and both are top quality. COAs are legit, shipping fast, packaging professional. Their prices are fair and they often throw in extra bacteriostatic water. Zero complaints!

Oct 14, 2025
shipping took forever
Elizabeth N.

Almost two weeks to arrive with no tracking updates for most of it. Product was okay when it finally got here but the wait was frustrating for a domestic order.

Sep 29, 2025
good prices
Brittany F.

Their GHK-Cu pricing is better than most places I checked. Vial arrived intact, decent packaging. Will probably order again.

Sep 7, 2025
COA wasn't batch specific
Cynthia D.

Product itself looked fine, lyophilized cake intact. My only gripe is the COA they sent looked generic and didn't match my lot number. Asked support about it and got a slow reply.

Aug 19, 2025
solid for a smaller vendor
Kenneth S.

Ordered BPC-157 and a GHK-Cu vial. Both showed up sealed and labeled, COA was in the email. Took about a week which is fine for me.

Share your experience

Purchased from Atlas Peptides? Help other researchers by leaving a review.

Sign in to Review

Community Discussions

Ask questions and share experiences

View All

Vendor Info

StatusUnclaimed
WebsiteVisit
Reviews20
Products10
Lab Tests0

Embed Badge

Atlas Peptides on amino.reviews