Biotech Peptides

US-based manufacturer of research peptides with in-house testing.

What Customers Mention

arrivedsealedpricepeptidefinedaysvialsipamorelin

Reviews

Apr 2, 2026
price crept up
Noah B.

Been a customer a while and noticed the BPC-157 price went up since last year. Still ships fast, just not the deal it was.

Feb 3, 2026
international shipping is slow
bryan_daily

Ordering from outside the US, took almost three weeks and a refund question dragged on. Domestic buyers probably have a better time.

Jan 21, 2026
GHK-Cu order
Chelsea J.

Good price on GHK-Cu and it shipped the same afternoon I ordered. Packaging was plain and a bit minimal but everything arrived intact.

Jan 8, 2026
fine, not amazing
Curtis D.

Decent vendor. Shipping is genuinely fast. Just wish they did independent lab testing instead of only their own.

Oct 28, 2025
COA wasn't batch specific
Thomas Y.

The certificate they sent was a generic one for the product, not tied to my actual lot number. Powder looked fine but I'd like the documentation to match.

Oct 1, 2025
TB-500 is fine but shipping took forever
Lucas Bennett

The TB-500 itself seems solid based on our lab analysis, but man the shipping was frustrating. Ordered on a Monday, didn't ship until Thursday, then took another 5 days in transit. That's nearly two weeks total which is way too long when you're running time-sensitive experiments. The peptide came properly packaged with ice packs and the COA showed decent purity at 96.8%. Customer service was slow to respond to my tracking inquiry. Price is competitive though. Would order again if they can fix their fulfillment speed, otherwise I'll probably try another vendor next time.

Aug 22, 2025
COA is in-house only
method_janet

Quality seems decent and the powder looked clean, but the COA they provide is their own lab, not an independent one. Would feel better with third party testing.

Share your experience

Purchased from Biotech Peptides? Help other researchers by leaving a review.

Sign in to Review

Community Discussions

Ask questions and share experiences

View All

Products (8)

Vendor Info

StatusUnclaimed
WebsiteVisit
Reviews24
Products8
Lab Tests0

Embed Badge

Biotech Peptides on amino.reviews