Biotech Peptides

US-based manufacturer of research peptides with in-house testing.

What Customers Mention

arrivedsealedpricepeptidefinedaysvialsipamorelin

Reviews

May 9, 2026
reliable
Laura P.

Nothing flashy, just fast shipping and products that show up as described. The ipamorelin reconstituted clear. Reordering.

Apr 23, 2026
happy with it
Megan I.

Ordered the BPC-157 and TB-500 blend, arrived fast and sealed. Easy reorder process. Good experience overall.

Mar 19, 2026
overnight option worth it
Naomi J.

Paid for overnight shipping and it actually showed up overnight. CJC-1295 vial sealed and labeled correctly. Will order again.

Feb 18, 2026
my go-to lately
Tessa U.

Stocked when others were sold out, fast shipping, COAs on the site for most products. Hard to argue with that.

Dec 15, 2025
reordering
research_michael

Quick shipping, vials sealed and labeled, price was fair. Reordering the Sermorelin and ipamorelin blend.

Nov 20, 2025
quick and easy
Donald R.

Checkout was simple, shipping notification came same day. Ipamorelin vials arrived sealed with intact lyophilized cake.

Verified Purchase
Nov 5, 2025
Solid BPC-157, happy with the purchase
Cameron Drake

I was asked to leave a review after my recent order. Got the BPC-157 for a shoulder injury research project and I'm genuinely impressed with how quickly it arrived. Packaging was professional with proper temperature control during transit. The vial came with a detailed COA showing 98.7% purity which is exactly what I need for our lab work. Customer service answered my questions about reconstitution within an hour which was helpful. Only minor gripe is the website checkout process felt a bit clunky, but that's not a dealbreaker. Price point is fair compared to other vendors I've used. The peptide dissolved cleanly without any cloudiness or particulates. Overall very satisfied and will probably order again when we need to restock our BPC supply.

Oct 14, 2025
solid source
Maria G.

Been ordering TB-500 from them on and off. Consistent, fairly priced, gets here fast. Does what I need.

Sep 27, 2025
Excellent semaglutide quality, good vendor
Priya Sharma

Fourth time ordering semaglutide from Biotech Peptides and they've been consistent every single time. The purity testing is legit - they post batch-specific COAs right on the product page which I really appreciate. Last batch came in at 99.2% purity with full HPLC results. Shipping took 4 days to the midwest which is reasonable. Packaging uses vacuum sealed pouches inside an insulated box with ice packs. My only complaint is they don't offer expedited shipping options, so if you need something fast you're out of luck. Their customer portal is clean and easy to navigate. Pricing is slightly higher than some competitors but the quality control seems worth it. The reconstitution guide they include is actually useful unlike the generic ones some vendors throw in. Would recommend for serious researchers who care about peptide integrity.

Sep 19, 2025
big catalog
Douglas W.

Hard to find a peptide they don't stock. Got Tesamorelin and GHK-Cu in the same order, both shipped same day.

Sep 3, 2025
good prices when there is a sale
Benjamin L.

Caught a sale on the CJC-1295 and ipamorelin blend and stacked a coupon, came out to a great price. Shipping was quick too.

Aug 9, 2025
fast shipping from the US
Gary N.

Ordered BPC-157 on a Monday and it was at my door Wednesday. Vials sealed and labeled fine. No complaints.

Share your experience

Purchased from Biotech Peptides? Help other researchers by leaving a review.

Sign in to Review

Community Discussions

Ask questions and share experiences

View All

Products (8)

Vendor Info

StatusUnclaimed
WebsiteVisit
Reviews24
Products8
Lab Tests0

Embed Badge

Biotech Peptides on amino.reviews