Element Peptides

Boutique peptide vendor emphasizing small-batch quality control.

What Customers Mention

shippingvialsdayspricefastfinequicklooked

Reviews

Aug 27, 2026
took a while but fine
Barbara R.

Order sat in processing for almost four days before it shipped, which is slower than their site led me to expect. Once it moved it got here quick and the CJC-1295 vials looked good with the COA included. Would order again, just plan around the processing time.

Jul 24, 2026
ice pack melted
Donna A.

The peptides made it fine but the cold pack they included was completely warm by the time the box reached me in July. Not sure how much good it did sitting in a mailer that long. Wish they used better insulation for summer shipments.

Jun 4, 2026
COA was not for my batch
katherine_m316

The semaglutide arrived quick and the vials looked fine. My issue is the COA they sent over was a generic one, not matched to the lot number on my vial. Asked support about it and got a vague answer. Knocking points for that.

May 4, 2026
no issues this time
Scott K.

Second order from them. Shipping was fine and vials were sealed and labeled properly. First order they were out of stock on what I wanted, so middle of the road for me.

Apr 6, 2026
prices went up
Morgan P.

Still a fine source but the retatrutide is noticeably more expensive than it was a few months back. Shipping is still quick at least.

Dec 9, 2025
wrong item shipped
Devin K.

Ordered tirzepatide and the box had semaglutide instead. They sorted it eventually but it took a few emails and the return window made me nervous.

Nov 2, 2025
decent but COA wasn't batch specific
nicole.p.recovery

Shipping was fine, about a week. The certificate they linked looked generic rather than tied to my actual batch. Would like to see lot numbers match.

Sep 7, 2025
good price, stock is hit or miss
benjamin.q.recovery

Pricing is genuinely cheap and the order I did get was quick. But half the catalog was sold out when I went back to reorder. Wish they kept things in stock.

Share your experience

Purchased from Element Peptides? Help other researchers by leaving a review.

Sign in to Review

Community Discussions

Ask questions and share experiences

View All

Products (7)

BPC-157$48.82
NAD+$51.96
PT-141$72.77
Semax$39.86
TB-500$26.76

Vendor Info

StatusUnclaimed
WebsiteVisit
Reviews25
Products7
Lab Tests0

Embed Badge

Element Peptides on amino.reviews