Element Peptides

Boutique peptide vendor emphasizing small-batch quality control.

What Customers Mention

shippingvialsdayspricefastfinequicklooked

Reviews

Jul 11, 2026
cheap and quick
Cole A.

Caught one of their sales and the GHK-Cu was a great deal. Out the door fast, here in two days.

Jun 21, 2026
solid reorder
Trevor B.

Second time buying the AOD-9604 from these guys. Both orders shipped same day and showed up fast since they are domestic. Prices have crept up a little since my first order but still reasonable.

May 28, 2026
good prices, plain box
Beatrice N.

No complaints on the TB-500 itself, vials were sealed well and the fill looked right. Packaging is bare bones though, just a padded mailer with the vials loose inside. For the price I will take it.

May 19, 2026
fast and cheap
Nicole R.

Ordered the BPC-157 on a sale and the price was honestly hard to beat. Tracking hit my inbox the next morning and it showed up in three days.

Mar 1, 2026
good experience overall
Mark I.

Checkout was simple, shipping took about five days, COA matched. Ipamorelin reconstituted clear. Would order again.

Jan 8, 2026
quick and cheap
Christopher N.

Three day delivery, vials looked clean and the lyophilized cake was intact. Hard to beat on price.

Nov 23, 2025
Outstanding Semaglutide experience
Tate Donovan

After testing Semaglutide from six different vendors over the past year for my research institution, Element Peptides has become my preferred source. The quality control is immediately apparent from the packaging - medical-grade vials with laser-etched lot numbers, properly crimped aluminum seals, and pharmaceutical-grade rubber stoppers. The included COA shows 99.6% purity via HPLC with full mass spectrometry data, which is more documentation than most vendors provide. The lyophilized peptide cake was flawless: uniform white color, no yellowing or degradation, firm structure that indicates proper lyophilization technique. Reconstitution with 2ml bacteriostatic water took approximately 20 seconds with gentle swirling, resulting in a crystal-clear solution with zero particulates or cloudiness. Shipping was impressively fast at 3 days despite ordering during a holiday week. The cold chain was maintained perfectly with gel packs still semi-frozen upon arrival. Customer service is exceptional - they answered detailed questions about their manufacturing process and third-party testing protocols within 2 hours. My only minor critique is the premium pricing at roughly 15% above budget vendors, but the consistency and quality justify the cost for serious research applications. The website interface is professional and the reordering process is streamlined. Element has earned my continued business and I've already placed two subsequent orders. Highly recommended for researchers who refuse to compromise on peptide quality and vendor transparency.

Oct 14, 2025
solid for the money
Michelle Q.

BPC-157 and TB-500 both arrived well packed in a small box. COA was on the site. Can't complain at these prices.

Sep 28, 2025
Semaglutide delivered as advertised
Celeste Yoon

First time trying Element Peptides after reading reviews here. Ordered 5mg Semaglutide and it arrived in 5 days packed with ice and bubble wrap. COA was included showing 99.2% purity which is solid for this peptide. Reconstituted smoothly with bacteriostatic water, completely clear solution. Vial presentation was professional with clean labels and proper lot numbering. Customer service reached out proactively after shipping to confirm receipt which was a nice touch. Price was competitive especially with the 10% first-time discount code. Shipping could have been slightly faster but no real complaints. The peptide cake looked pristine and white. Planning to order their TB-500 next based on this experience.

Sep 21, 2025
TB-500 quality exceeded expectations
Colton Briggs

Ordered TB-500 after my usual vendor was out of stock. Element had it available and shipped same day which was clutch for my research timeline. Product arrived in 4 days with cold pack and professional packaging. COA showed 98.6% purity with detailed HPLC chromatogram. The peptide reconstituted perfectly clear with no cloudiness or particulates. Vial crimping was tight and sterile seal was intact. Customer service was helpful when I asked about their testing methods - they use third party labs which adds credibility. Pricing is reasonable for the quality tier. Only knocked one star because their website checkout process was a bit clunky. Would definitely order from Element again for TB-500 or other peptides.

Aug 19, 2025
fast shipping
Nicholas A.

Ordered tirzepatide on a Monday and it landed Thursday. Vials sealed and labeled fine. Prices are some of the best I've found.

Share your experience

Purchased from Element Peptides? Help other researchers by leaving a review.

Sign in to Review

Community Discussions

Ask questions and share experiences

View All

Products (7)

BPC-157$48.82
NAD+$51.96
PT-141$72.77
Semax$39.86
TB-500$26.76

Vendor Info

StatusUnclaimed
WebsiteVisit
Reviews25
Products7
Lab Tests0

Embed Badge

Element Peptides on amino.reviews