Rasa Research

Research peptide supplier with focus on metabolic and anti-aging peptides.

What Customers Mention

finesealedvialsarrivedshippingpackagingsemaglutidepricing

Reviews

Jul 13, 2026
echeck hold was a pain
Greta X.

Paid by eCheck for my first order and there was a 5 to 7 day hold before anything shipped. Wasn't clearly flagged at checkout. Once it cleared it moved fine but that wait soured the experience.

Jul 1, 2026
they made it right
Aaron Q.

Had an order where one vial cracked in transit, packaging was honestly a little thin for glass. Emailed them photos and they put a replacement on priority shipping plus tossed in an extra. Did not expect that level of service from a research supplier and it turned me into a repeat customer.

Jun 22, 2026
support went quiet after the sale
Regina C.

First order with Rasa was smooth, but when I emailed a follow-up question about a second order I never got a reply. Three messages, nothing back. The product itself showed up fine so it's not a disaster, but the silence after they have your money is frustrating and it's the main reason I'm only at three stars here.

Jun 11, 2026
good prices on retatrutide
Victor E.

Their reta pricing beat the two other domestic places I checked. Shipped quick, packed okay. Would order again.

Jun 3, 2026
decent but i wish there was a real coa
Daniel G.

Product arrived sealed and the website was easy enough to order from. My main gripe is the testing situation, it's all in-house and there's no batch-specific third party sheet in the box. For domestic GLP-1 pricing it's competitive, just wish they were more transparent on that front.

May 27, 2026
vials looked underfilled to me
Connor G.

The semaglutide vials came in fine but a couple of them were noticeably below the fill line compared to the others in the same box. Reached out and got a fairly generic answer about minimum concentration. Not what I expected for the price.

May 18, 2026
fast shipping
Vivian Q.

Ordered the tirz on a Tuesday and it was at my door Friday. No complaints on speed.

May 7, 2026
would order again maybe
Keith L.

Tirzepatide came sealed and on time, no problems. Just wish their COAs were more detailed and stock was steadier.

Apr 12, 2026
plain packaging but fine
Felicia Q.

Nothing fancy, just a padded envelope, but the vials arrived intact and sealed. Shipping was reasonable. Average source.

Mar 9, 2026
happy customer
Brett U.

Quick shipping, vials labeled and sealed, fair pricing. Has worked out well for me a few times now.

Feb 21, 2026
price went up
Kevin R.

Reordered semaglutide and the price had jumped noticeably from last time. Product itself was sealed and fine, but not the deal it used to be.

Feb 2, 2026
out of stock a lot
Lance U.

Half the things I wanted were unavailable when I checked. What I did order arrived fine and well packed.

Jan 19, 2026
good price on tirz
Cole G.

Best tirzepatide price I found at the time and the order showed up quick. Vials sealed properly. Happy with it.

Jan 4, 2026
ok experience
Holly Z.

Retatrutide arrived in good shape, packaging was fine. Took about six days which is a bit slow for domestic.

Dec 18, 2025
COA mismatch
Brian F.

The certificate I got didn't match the lot on my vial at all. Support brushed it off when I asked. Won't reorder.

Dec 6, 2025
no issues
Marcus G.

Third order with Rasa. Shipping is consistent and the vials always show up sealed and intact. Reliable enough.

Nov 28, 2025
decent value
Mary X.

Pricing is the main draw. Semaglutide came sealed and on time. Just wish they posted batch specific testing.

Nov 15, 2025
slow to respond
Karen I.

Had a question before ordering and it took four days to hear back. Eventually placed the order and it was fine, but the support side needs work.

Nov 3, 2025
quick turnaround
Brandon H.

Shipped within a day of payment and showed up fast. Tirzepatide vials labeled clearly. Would order again.

Oct 28, 2025
Great selection for melanocortin research
Leo Hartman

Rasa Research has become my preferred vendor for both Melanotan II and CJC-1295. We're running comparative studies on melanocortin receptor agonists and need reliable sourcing for multiple peptides. Their catalog is extensive and well-organized, which makes ordering straightforward. Both peptides arrived within a week with comprehensive third-party COAs showing >98% purity. What impressed me most was the technical data sheets they include—detailed information on storage conditions, reconstitution protocols, and stability data that many vendors don't bother providing. Their customer service team is responsive and knowledgeable. I had a question about the difference between CJC-1295 with and without DAC, and their rep gave me a thorough explanation with citations. Packaging is excellent with vacuum-sealed vials and cold packs. Prices are reasonable, not the cheapest but fair for the quality. My only minor complaint is that their website checkout process is a bit clunky. Overall, solid vendor for serious research applications.

Share your experience

Purchased from Rasa Research? Help other researchers by leaving a review.

Sign in to Review

Community Discussions

Ask questions and share experiences

View All

Products (5)

Vendor Info

StatusUnclaimed
WebsiteVisit
Reviews28
Products5
Lab Tests0

Embed Badge

Rasa Research on amino.reviews