R
Rasa Research
Research peptide supplier with focus on metabolic and anti-aging peptides.
What Customers Mention
finesealedvialsshippingarrivedpackagingsemaglutiderasa
Dec 18, 2025
COA mismatch
The certificate I got didn't match the lot on my vial at all. Support brushed it off when I asked. Won't reorder.
Share your experience
Purchased from Rasa Research? Help other researchers by leaving a review.
Sign in to ReviewCommunity Discussions
Ask questions and share experiences
Products (5)
Vendor Info
| Status | Unclaimed |
| Website | Visit |
| Reviews | 30 |
| Products | 5 |
| Lab Tests | 0 |