Rasa Research

Research peptide supplier with focus on metabolic and anti-aging peptides.

What Customers Mention

finesealedvialsshippingarrivedpackagingsemaglutiderasa

Reviews

Aug 8, 2026
fine, nothing special
Walter A.

It's a middle of the road vendor. Shipping was reasonable, packaging was plain but did the job, prices are okay. Nothing stood out good or bad.

Jun 22, 2026
support went quiet after the sale
Regina C.

First order with Rasa was smooth, but when I emailed a follow-up question about a second order I never got a reply. Three messages, nothing back. The product itself showed up fine so it's not a disaster, but the silence after they have your money is frustrating and it's the main reason I'm only at three stars here.

Jun 3, 2026
decent but i wish there was a real coa
Daniel G.

Product arrived sealed and the website was easy enough to order from. My main gripe is the testing situation, it's all in-house and there's no batch-specific third party sheet in the box. For domestic GLP-1 pricing it's competitive, just wish they were more transparent on that front.

May 7, 2026
would order again maybe
Keith L.

Tirzepatide came sealed and on time, no problems. Just wish their COAs were more detailed and stock was steadier.

Apr 12, 2026
plain packaging but fine
Felicia Q.

Nothing fancy, just a padded envelope, but the vials arrived intact and sealed. Shipping was reasonable. Average source.

Feb 2, 2026
out of stock a lot
Lance U.

Half the things I wanted were unavailable when I checked. What I did order arrived fine and well packed.

Jan 4, 2026
ok experience
Holly Z.

Retatrutide arrived in good shape, packaging was fine. Took about six days which is a bit slow for domestic.

Nov 28, 2025
decent value
Mary X.

Pricing is the main draw. Semaglutide came sealed and on time. Just wish they posted batch specific testing.

Oct 19, 2025
mixed feelings
nicole_coach

First retatrutide order was great, second one the powder reconstituted a little cloudy. Hard to say if it was a one off.

Oct 9, 2025
Semaglutide quality issues
Ruby Anderson

Ordered Semaglutide for metabolic studies and the vial arrived with visible particles floating in the solution. Reached out to Rasa and they eventually sent a replacement, but it took almost two weeks. Replacement tested fine, but the initial quality control issue is concerning for a premium-priced vendor.

Oct 8, 2025
fine but nothing special
Thomas V.

Order arrived in about a week. Quality seemed ok. Catalog is a little thin compared to other sources though.

Aug 21, 2025
COA was generic
Megan H.

Got my retatrutide fine and the powder looked good, but the COA they sent wasn't batch specific. Asked support and never really got a straight answer.

Share your experience

Purchased from Rasa Research? Help other researchers by leaving a review.

Sign in to Review

Community Discussions

Ask questions and share experiences

View All

Products (5)

Vendor Info

StatusUnclaimed
WebsiteVisit
Reviews30
Products5
Lab Tests0

Embed Badge

Rasa Research on amino.reviews