R
Rasa Research
Research peptide supplier with focus on metabolic and anti-aging peptides.
What Customers Mention
finesealedvialsarrivedshippingpackagingsemaglutiderasa
Jul 1, 2026
they made it right
Had an order where one vial cracked in transit, packaging was honestly a little thin for glass. Emailed them photos and they put a replacement on priority shipping plus tossed in an extra. Did not expect that level of service from a research supplier and it turned me into a repeat customer.
Share your experience
Purchased from Rasa Research? Help other researchers by leaving a review.
Sign in to ReviewCommunity Discussions
Ask questions and share experiences
Products (5)
Vendor Info
| Status | Unclaimed |
| Website | Visit |
| Reviews | 31 |
| Products | 5 |
| Lab Tests | 0 |
Embed Badge
