Receptor Chem

UK manufacturer of research SARMs and peptides with batch testing.

What Customers Mention

daystookarrivedvialsshippingemailfinetracking

Reviews

Aug 21, 2026
been ordering here since last year and it has mostly been smooth
Emma Y.

I've put through maybe eight or nine orders with Receptor Chem now across BPC-157, TB-500, KPV and a couple of the blends. The good: domestic shipping is genuinely fast, usually two or three days with Royal Mail, the boxes are plain and discreet, and the vials have always been filled to the right level with no cracked stoppers. The catalogue is also broader than most UK competitors so I can keep it to one order. The not-so-good is the same thing everyone says, the COAs. They're not in the box and you have to email for them, the response can take days, and when one finally arrives it's a generic chromatogram rather than something matched to your actual batch. I compared against a couple of other sources who send batch-specific paperwork automatically and Receptor Chem clearly lags there. One order back in spring also went quiet for over a week with no tracking before it suddenly shipped. So not perfect, and the support side really needs work, but the products turn up, they're consistent, and the pricing is fair. I keep reordering, which probably tells you enough.

Jul 16, 2026
good range, took a bit to ship
Felix T.

The catalogue is the main draw, they stock things other UK sites just don't. My order sat as processing for four days before it moved which was longer than I expected, but once posted it came fast and everything was sealed and intact.

Jun 1, 2026
solid go-to in the UK
Richard Z.

Been using Receptor Chem as my default for a while now. The range is huge so I can get most things in one order, stock is usually there, and domestic shipping is genuinely quick. Documentation could be better but for a UK source they're hard to beat.

May 18, 2026
fast UK delivery
Logan L.

Ordered BPC-157 on a Sunday evening and Royal Mail had it to me Tuesday morning. Plain box, nothing on the label to give it away. No complaints on the shipping side at all.

Apr 19, 2026
solid for a long-time UK source
Thomas U.

Ordered the GLOW blend, came in 3 days nicely packed. They've been around forever and the COAs are proper. CS could be faster though.

Feb 7, 2026
happy with the testing transparency
Carla F.

Appreciated seeing the actual HPLC and FT-IR results on the PT-141 listing rather than a vague COA. Delivery was three days.

Jan 26, 2026
Reliable vendor with consistent quality
Carolyn Steele

I've ordered Ipamorelin, BPC-157, and MK-677 from Receptor Chem three times now for lab work. The COAs are always included and match batch numbers perfectly. Shipping is usually 7-10 days to the US. Customer service responded to my reconstitution question within a few hours. Only complaint is the pricing is a bit higher than competitors, but I'm willing to pay for the reliability. Their site is easy to navigate and checkout is quick. Overall a solid choice for research peptides.

Jan 9, 2026
priced well
Brenda I.

Cheaper than most UK sources I checked for GHK-Cu. Arrived in four days, plain padded envelope, vial intact.

Nov 16, 2025
big catalogue, did the job
Samuel Q.

They carry pretty much everything, got the KLOW blend along with Semax. Both vials filled correctly and packaging was discreet.

Oct 8, 2025
good UK delivery speed
training_allison

TB500 here in two working days. Vials labelled clearly and the lyophilised cake looked intact. No complaints on this order.

Aug 7, 2025
COA docs are thorough
Peter P.

What I like is the full chromatograms on each product page, not just a one-pager. BPC-157 batch matched. Took 4 days within the UK.

Share your experience

Purchased from Receptor Chem? Help other researchers by leaving a review.

Sign in to Review

Community Discussions

Ask questions and share experiences

View All

Vendor Info

StatusUnclaimed
WebsiteVisit
Reviews33
Products8
Lab Tests0

Embed Badge

Receptor Chem on amino.reviews