Receptor Chem

UK manufacturer of research SARMs and peptides with batch testing.

What Customers Mention

daystookarrivedvialsshippingemailfinetracking

Reviews

Aug 7, 2026
reliable
training_jack

Easy website, fast checkout, order with me in two days. Receptor Chem just works.

Jun 9, 2026
no notes
Brandon I.

Quick dispatch, discreet packaging, vials filled properly. Third order and it's been the same every time.

Jan 26, 2026
Best peptide vendor I've used
Lindsey Pope

Just received my second order of CJC-1295 and TB-500 from Receptor Chem and I'm consistently impressed. The peptides are pharmaceutical grade with full COAs, packaging is discreet and professional, and they even threw in a free BAC water vial this time. Shipping from UK to US took 8 days which is reasonable. Their website has detailed product descriptions and research citations which I appreciate. Definitely my go-to vendor for research compounds now.

Dec 11, 2025
reliable for me
Brittany R.

Several orders now and every one has arrived. MK-677 and BPC-157 last time, both well packed. Just don't expect quick email replies.

Sep 14, 2025
been using them for years
Wesley C.

One of the few UK sources I've stuck with since they've been around so long. Ipamorelin and CJC arrived in 3 days, plain box as always.

Share your experience

Purchased from Receptor Chem? Help other researchers by leaving a review.

Sign in to Review

Community Discussions

Ask questions and share experiences

View All

Vendor Info

StatusUnclaimed
WebsiteVisit
Reviews33
Products8
Lab Tests0

Embed Badge

Receptor Chem on amino.reviews