S
Spring Peptide
Asian peptide manufacturer offering wholesale and retail research peptides.
What Customers Mention
arriveddaysvialsfinepeptidepackagingvialsealed
Feb 22, 2026
out of stock a lot
Half the peptides I wanted were out of stock, including MK-677. What I did get was fine but the availability is frustrating.
Oct 8, 2025
shipping took forever
Two weeks to get my order and the tracking didn't update for most of that. Emailed support twice before I heard anything back.
Share your experience
Purchased from Spring Peptide? Help other researchers by leaving a review.
Sign in to ReviewCommunity Discussions
Ask questions and share experiences
Products (4)
Vendor Info
| Status | Unclaimed |
| Website | Visit |
| Reviews | 13 |
| Products | 4 |
| Lab Tests | 0 |
Embed Badge
