S
Spring Peptide
Asian peptide manufacturer offering wholesale and retail research peptides.
What Customers Mention
arriveddaysvialsfinepeptidepackagingvialsealed
Jan 19, 2026
underfilled vial
One of my GHK-Cu vials looked a bit short on fill compared to the others. Not a huge deal but worth mentioning. Everything else was fine.
Dec 3, 2025
support is slow
Had a question about a tirzepatide order and it took three days to get a reply. Once they did respond they were helpful enough.
Oct 27, 2025
ok but plain packaging
No ice pack in the box and it was pretty plain, just bubble wrap. Vials were fine but I'd expect a little more for the price.
Sep 2, 2025
COA was generic
Product seems fine but the COA they sent wasn't batch-specific, just a general one for the peptide. Would prefer to see the actual lot tested.
Share your experience
Purchased from Spring Peptide? Help other researchers by leaving a review.
Sign in to ReviewCommunity Discussions
Ask questions and share experiences
Products (4)
Vendor Info
| Status | Unclaimed |
| Website | Visit |
| Reviews | 13 |
| Products | 4 |
| Lab Tests | 0 |
Embed Badge
