Spring Peptide

Asian peptide manufacturer offering wholesale and retail research peptides.

What Customers Mention

arriveddaysvialsfinepeptidepackagingvialsealed

Reviews

Apr 11, 2026
no complaints
David H.

Ordered retatrutide, checkout was simple and it arrived in five days. Vial sealed properly and labeled clearly. Fair price too.

Dec 28, 2025
Quick delivery, solid products
Sawyer Grant

Grabbed Semax and BPC-157 from Spring Peptide last week. Arrived in 3 days which was faster than expected. Both vials look good, COAs included showing 98%+ purity. Packaging was secure with cold packs. Prices are fair and checkout was easy. Happy with the order, will use them again.

Nov 15, 2025
reordered
Matthew G.

Second order of CJC-1295 and it's been consistent both times. Powder reconstituted clear, no issues. Solid little vendor.

Oct 24, 2025
Melanotan II - good experience overall
Eloise Carr

First time trying Spring Peptide and ordered Melanotan II for my research. Product arrived in 6 days with proper packaging including ice packs and bubble wrap. The vial was sealed well and came with a COA showing 98.7% purity which is what I'm looking for. Price was middle of the range, not the cheapest but reasonable. Their customer service answered my question about batch testing within a few hours. Website is clean and easy to use. Only thing I'd change is they could include more detailed storage instructions with the shipment. Overall satisfied and would order again.

Sep 21, 2025
good pricing
Tara S.

Their ipamorelin pricing is better than a couple other places I checked. Vials arrived intact and the lyophilized cake looked good.

Aug 14, 2025
decent first order
Courtney A.

Ordered BPC-157 and TB-500, both showed up well sealed and labeled with the batch number. Took about a week to arrive, no complaints there.

Share your experience

Purchased from Spring Peptide? Help other researchers by leaving a review.

Sign in to Review

Community Discussions

Ask questions and share experiences

View All

Products (4)

BPC-157$66.26
CJC-1295$70.65
Semax$60.93

Vendor Info

StatusUnclaimed
WebsiteVisit
Reviews13
Products4
Lab Tests0

Embed Badge

Spring Peptide on amino.reviews