S
Spring Peptide
Asian peptide manufacturer offering wholesale and retail research peptides.
What Customers Mention
arriveddaysvialsfinepeptidepackagingvialsealed
Dec 29, 2025
great experience
Honestly impressed. Ordered semaglutide, shipped next day, came in a proper insulated box with a cold pack. COA matched the lot. Will be back.
Share your experience
Purchased from Spring Peptide? Help other researchers by leaving a review.
Sign in to ReviewCommunity Discussions
Ask questions and share experiences
Products (4)
Vendor Info
| Status | Unclaimed |
| Website | Visit |
| Reviews | 13 |
| Products | 4 |
| Lab Tests | 0 |